LL-37 10mg⁠

LL-37 10mg⁠. In innate immunity and cellular defense models, LL-37—the primary active cleavage product of the human cathelicidin precursor protein hCAP18—serves as a vital benchmark reagent. Known for its amphipathic alpha-helical structure, LL-37 interacts directly with microbial cell membranes, lipopolysaccharide (LPS) molecules, and chemokine receptor networks. When sourcing an LL-37 10mg research vial, maintaining strict chemical purity and structural integrity is non-negotiable for reproducible cellular assays.

1. Structural Characteristics of the LL-37 Peptide

LL-37 consists of a 37-amino acid sequence starting with two leucine residues. Its unique net positive charge (+6) allows it to electrostatically target negatively charged lipid bilayers in bacterial and cellular assay models:

Sequence: [LL-37, 37 aa]

Because synthesis errors in long 37-mer chains can lead to truncated sequences that compromise membrane-disruption metrics, utilizing HPLC-verified LL-37 (>99% purity) is essential to avoid anomalous experimental readouts.

2. Primary In Vitro & In Vivo Assay Targets

Laboratories incorporate LL-37 10mg reagents across multiple specialized biological domains:

  • LPS Neutralization Assays: Evaluating how LL-37 binds to circulating bacterial endotoxins to mitigate pro-inflammatory cytokine cascades.
  • Epithelial Cell Re-epithelialization: Tracking FPR2/ALX receptor pathway modulation during cellular migration and tissue remodeling studies.
  • Angiogenesis & Chemotaxis Models: Assessing vascular endothelial growth factor (VEGF) pathway recruitment in tissue response assays.

Order HPLC-Verified LL-37 10mg Vials

Secure ultra-pure, lyophilized LL-37 10mg research assets backed by transparent lot-specific testing data.

Buy LL-37 10mg Vials
High-Purity LL-37 10mg Reagent Vials for Host-Defense Assays⁠ Figure 1: Lyophilized LL-37 10mg peptide research vial in sterile laboratory environment⁠.

3. Laboratory Storage and Handling Parameters

To prevent degradation of the 37-amino acid chain, follow standard sub-zero preservation protocols:

  • Store dry, lyophilized vials at -20°C immediately upon arrival.
  • Reconstitute using sterile bacteriostatic water or endotoxin-free PBS.
  • Aliquots should be stored at sub-zero temperatures to avoid degradation from repeated freeze-thaw cycles.

⚠️ Preclinical Integrity Notice

All laboratory assets documented within this registry are distributed exclusively for verified laboratory research, analytical control trials, and foundational in vitro testing models. This chemical compound is strictly not approved for human therapeutic, clinical, veterinary, or diagnostic administration.